SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041010 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041010
Domain Number 1 Region: 83-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.2e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.72e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0000952
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041010   Gene: ENSMMUG00000020989   Transcript: ENSMMUT00000047972
Sequence length 240
Comment pep:novel scaffold:MMUL_1:1099548049568:397011:406105:-1 gene:ENSMMUG00000020989 transcript:ENSMMUT00000047972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHMTMRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFESRPKLATWRQRVEAAVGEDLFREAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Download sequence
Identical sequences ENSMMUP00000041010 9544.ENSMMUP00000041010 ENSMMUP00000041011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]