SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041074 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041074
Domain Number 1 Region: 44-214,261-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1103-1366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-33
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 780-935,978-1054
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.34e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 515-652
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000549
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000041074
Domain Number - Region: 1374-1453
Classification Level Classification E-value
Superfamily EF-hand 0.00199
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041074   Gene: ENSMMUG00000008618   Transcript: ENSMMUT00000048033
Sequence length 1988
Comment pep:known chromosome:MMUL_1:X:47057352:47083678:-1 gene:ENSMMUG00000008618 transcript:ENSMMUT00000048033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRRNQHSKHKTVAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVA
LGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDF
IIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLN
SIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDLEAEEDPSPCASSGS
GRACTLNQTECRGRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELP
WVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWI
TQAEELDMEDPSADGNLGSMASSLPASDTGSMTETQGDEDEEEGALASCTRCLNKIMKTR
VCRRLRRANRVLRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPVWLTQIQGTPPA
CQSSPPASYSFYPRSLNPGPLRCGASAPKTLPFPPNKSRALSLFHPTLHWASLSNLVASL
LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILT
GEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTA
KDKESLTGNPSDTPTTRDASRHPGNPHLQIPSASPITPISSHREKSSEKDLPPENEGLVP
GVEKEEEEGTRREGAGAGGVELLQEVVPKEKVVPIPEGSAFFCLSQTNPLRKGCHTLIHH
HVFTNLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFL
HRGSFCRSWFNMLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYTCTDEAKHTPQECNIHRGSFLVY
PDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIY
NYRVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQCVEYALKA
QPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFNYAMDILNM
VFTGLFTIEMVLKIIAFKPKHYFTDAWNTFDALIVVGSVVDIAVTEVNVRTGLSTNPLSP
YTPSSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIF
FIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRC
DPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
LDEFKRIWSEYDPGAKGHIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSD
GTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMKQKLLDEVIPPPDEEEV
TVGKFYATFLIQDYFRKFRRRKEKGLLGNEAAPSTSSALQAGLRSLQDLGPEMRQALTLE
TNKVRTSFHSPRNLIVKYFVNPLSDFDTASGKKPPHPREAPSAIEKYLFPPSRRGSRISV
SLPVGDRLPDSLSLGPSDDDRGTPTSSQPSVPQAGSNTHSLDNTQAVERKNFKNFFRVSS
LSTLIFFETFGPSDEMDIYIPEEGNSQPKGTRGQDKQDEDEEVPDRYTGHTTWDESMSWG
GGGVGTGSRRTVGAPSPRPRPRPKFLLPPHRAQRYMDGHLAPRRRLLPPTPAGRKPSFTI
QCLQRQGSCEDLPIPGTYHRGRNSGPNRAQVRLWRWCWGLGSGEAQGSWATPPQRGRLLY
APLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLG
LFARDPRFVALAKQEIADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGD
EMACVHAL
Download sequence
Identical sequences ENSMMUP00000017052 ENSMMUP00000041074 9544.ENSMMUP00000041074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]