SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041098 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041098
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 23-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 615-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 671-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 9 Region: 727-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000526
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 244-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000222
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041098   Gene: ENSMMUG00000010404   Transcript: ENSMMUT00000048058
Sequence length 779
Comment pep:known_by_projection chromosome:MMUL_1:X:45264185:45304256:-1 gene:ENSMMUG00000010404 transcript:ENSMMUT00000048058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANGDSPPWYPVVAAEGRGSSCEASVSFEDVTVDFSREEWQHLDPAQRRLYWDVTLENY
SHLLSVGYQVPKSEAAFKLEQGEGPWTLAGEAPHQSCSGEAIEKMQQQGIPGEIFFHCER
FDQPIGEDSLCSILEALWQDNDQLERCQENQNNLLSHVKVLIKERGYERKNIEKIIHVTT
KFVPSIKRLRNCDTILKHTLNLHNHSRNSATKNLGKIFGNGNNFPHSPSSTKIENAKTGA
NSCEHDHYEKHLSHKQALTHHQKIHPEEKLYVCTECVTGFTQKSHLFEHQRIHAGEKSRE
CDKSNKVFPQKPQVDAHLSVYTAEKPYLCTQCGKVFTFKSSLVTHQKIHTGQKPYKCSEC
GKAFIQRSDLFRHLRIHTGEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAF
TRKSALRMHQRIHTGEKPYVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCRKSFTKKS
QLHVHQRIHTGEKPYICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIK
HQKTHTGEKPYKCNGCGKAFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRI
HTGEKPYVCPECGKAFIQKSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGE
KPNICAECGKAFTDRSNLITHQKIHTREKPYKCGDCGKTFTWKSRLNIHQKSHTGERHYE
CSKCGKAFIQKATLSMHQIIHTGKKPYACTECQKAFTDRSNLIKHQKTHSGEKRYKASD
Download sequence
Identical sequences F7D3D2
ENSMMUP00000013643 ENSMMUP00000041098 9544.ENSMMUP00000041098 ENSMMUP00000013643 XP_001093860.1.72884 XP_014982779.1.72884 XP_014982780.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]