SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108803546|ref|YP_643483.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108803546|ref|YP_643483.1|
Domain Number 1 Region: 83-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000017
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108803546|ref|YP_643483.1|
Sequence length 157
Comment hypothetical protein Rxyl_0701 [Rubrobacter xylanophilus DSM 9941]
Sequence
MGDDLDIIFWAVVAALAFIGEIFTVSFFLLFFCAGALVALALAAAGLGVGLQAAGFVAAT
VLSMAALRPAIVNRISLRGGERYEPRGGIAGRSGVVTDPIEPGSSGTVRIGSGEFWSARA
VYPGQRIEAGARVRVLDTDGLTALVEPLEGGEGGEKR
Download sequence
Identical sequences Q1AY57
266117.Rxyl_0701 WP_011563689.1.70533 2005410147 gi|108803546|ref|YP_643483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]