SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108804500|ref|YP_644437.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804500|ref|YP_644437.1|
Domain Number 1 Region: 127-263
Classification Level Classification E-value
Superfamily Sortase 2.62e-30
Family Sortase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108804500|ref|YP_644437.1|
Sequence length 267
Comment peptidase C60, sortase A and B [Rubrobacter xylanophilus DSM 9941]
Sequence
MLAIRSAARRGGALALLLLFCLLLWGCGGAARGPGGGHGSAESPSPKPAEATAGEAAHSP
GGRRVEALLPEEVLSEEELEREAPGYRDWYRPAGEKVRPVSGAGGSSAGAIPAVRPFNFG
RDPGGPKDKTLYLTVPKIGLSRVPVYNSTSEEDLRRSAVHVPATGFPWQEGANVFIAGHR
LGYAGTGSHLVFYDLPRLEPGDEIILEDATGGRYVYRVFRELTVGPENVEVMNPVEGRSV
VSLQTCTLPDYSERIIVQGELVGEKPA
Download sequence
Identical sequences Q1AVF3
gi|108804500|ref|YP_644437.1| 266117.Rxyl_1664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]