SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108804687|ref|YP_644624.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108804687|ref|YP_644624.1|
Domain Number 1 Region: 16-168
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.13e-48
Family NADH:FMN oxidoreductase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 245-380
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.66e-18
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 3 Region: 174-238
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000634
Family CAP C-terminal domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108804687|ref|YP_644624.1|
Sequence length 393
Comment GntR family transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
Sequence
MDSTGIEQDSTSGRFVDRDLFRDVIGHFASGVTIITARHKETNFGITASAVCSLSLDPPM
LLVCVNKKTGTRHAIAESKAFAVNILHEDQGELAARFARPNTDKYRGVEIVYGELGEPLL
KDALAHLECRVVEEVTAGTHSVFLAEVQNAWAKEGTPLTYFRGKFGRFQEASDERVYREI
RQLVLERDVPAGQSITINDLAYQLDAPRQAVYYAMTRLEAEGLVTREEEGRYVVSPLDSE
TLNGALDTRCALEVGAAEKAVGRISNEELAELRRRMEATLFSGEGRPVSAERYVEANAAF
HEYTVALANNPTLLETYRQLTAEAVMSSALRAALEADDEFAGEQLKTLAEDHVRLTEAFE
AGDLEEAKRVVRRHTEAAKRLGRYLMDSAGGSL
Download sequence
Identical sequences Q1AUW6
WP_011564828.1.70533 gi|108804687|ref|YP_644624.1| 266117.Rxyl_1858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]