SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108805587|ref|YP_645524.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108805587|ref|YP_645524.1|
Domain Number 1 Region: 76-216
Classification Level Classification E-value
Superfamily Sortase 4.58e-29
Family Sortase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108805587|ref|YP_645524.1|
Sequence length 218
Comment peptidase C60, sortase A and B [Rubrobacter xylanophilus DSM 9941]
Sequence
MLHFPWSMKKYNYRKSRLKALLSGLLSLAMIAAGVALIASFFFAGNLGSLATNSDDPGGF
NVPNLGSGEAVSGGPEDKTLRLTIPAMSRVEDAVVPTVPGSDVEALDSHKAIHLEGTGFP
WEQEANVYIAGHRLGYPGTDSFLAFYDLDKLEDGDKVYVTDANGTTYTYEVFREFVVDPS
NLSVTKPIPGKNILTLQTCTLPDYSQRIIVQAELVDVS
Download sequence
Identical sequences Q1ASB6
WP_011565721.1.70533 gi|108805587|ref|YP_645524.1| 266117.Rxyl_2799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]