SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108803524|ref|YP_643461.1| from Rubrobacter xylanophilus DSM 9941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108803524|ref|YP_643461.1|
Domain Number 1 Region: 12-217
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.26e-41
Family Phospholipase D 0.014
Further Details:      
 
Domain Number 2 Region: 223-363
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-29
Family Nuclease 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108803524|ref|YP_643461.1|
Sequence length 466
Comment phospholipase D/transphosphatidylase [Rubrobacter xylanophilus DSM 9941]
Sequence
MEEPGRELLDRAMRRACGAPLRSGNRLELLRDGPATYDSWLAAIEGARRWVHLENYIFSD
DGVGRRFAEALSRKAREGVAVRVLYDWFGCLDVRSSFWEGLRRAGVEACPVNAPSLREPR
DLLPRDHRKLLAVDGEYASVGGVCLSEGWLERSPKTGLPYRDTCVAVRGPAVADAERAFA
GVWDLFARRPLPPEERPGPGEVPGAGEVAARVVAQEPGRARMLRALELLLASVRERVWIS
DPYFLGSPVLTQALVSAAADGVDVRLLLPATNDLPWIGALSRIGYRPLLEAGVRIFEYGG
PMMHAKTHVADSFHSRVGSTNLNFSGLLANWEADLLAEDAGFAARMEEMFEEDFSNAREI
LLHRGRRPRPQRPMSRSERRDRRRTMRRVRRGSGGTASRIGEEALHSATFSPASYERRVK
GALSAGLLALSVLGARHPRLISWPLAAAGAAAGVLGLLRALRGGGP
Download sequence
Identical sequences Q1AY79
gi|108803524|ref|YP_643461.1| 266117.Rxyl_0679 WP_011563667.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]