SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_01577 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_01577
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Ribosomal protein L13 0.000000000000131
Family Ribosomal protein L13 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RO3T_01577
Sequence length 115
Comment | RO3G_01578 | Rhizopus oryzae hypothetical protein (116 aa)
Sequence
MVPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVG
WKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVESKADSVKEINSAIAVLGH
Download sequence
Identical sequences I1BKZ4
RO3T_01577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]