SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_02486 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_02486
Domain Number 1 Region: 681-880,977-1159
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.14e-40
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 1304-1450,1502-1550,1584-1744
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 8.89e-40
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 3 Region: 213-504
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.66e-24
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Domain Number 4 Region: 12-235
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000000243
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RO3T_02486
Sequence length 2047
Comment | RO3G_02487 | Rhizopus oryzae hypothetical protein (2048 aa)
Sequence
MESTDYQVILWFDANSHILYRSENQGKEWYQVNGIGNNIEYLYEHPYDNNRAYVLSSGKT
HWKTTDKGKTWQEFHTRSESGASSSHLSFHAERSGYILFSGISCKLGSWTGVDCQNTVYY
TYDNFETTHPLRSHVTSCIWSLSSSEFRNAPTNDIMCIESASGQTGLLNSNDLQLIRSDN
FFHTHKVVDFGLGKPMLGVVAVSAVGRFIVAAVNPTDKQDMLLYVTMDGQTWHEAIFPEG
AALQEKSFTLIESSNPALMVDVLAGDAHAQFGSLYKSNSNGTFFVKSLENTNRNSMGYID
VERIPGVEGILIANQIINPRQVESQMVEKVVQTRISFDDGGSWKPITNVKGLECHDSECA
LHLHSVTSNHNFGQVASSQTAVGVLMGVGSYGSSLLNYDECDTFLSIDGGISWQRVREGA
HMYEFGDMGTLIVAVDDEKETDHVWWSKDRGTNWEKLSLGMTVRARALTTDPESTSRKFL
LIAGSVRSSDQKNVQIFQLDFSNIFSRQCQLDKNNDANSDFEKWYARDLTEGADCLMGHE
QIFYRRKADRDCYVGREFQDPEVEVKNCPCTRADYECDYNFARDKNGDCVRIGPDRIFAN
QCTSKDDYYAASSGYRIISGNTCIPPSRGRLDYPVERKCSENIAGIVPSPEDQNIAEGEK
EISRYQITFNSEIEQFLYFKDSEAILVRLQVGELWRSGNQGVDWTRVLENEGIIHNVVLH
EFDNNRAYAILQDGIYFTEDQGQTWHSIKVPAPPSERVPQTLDFHPVQKDWLLFIGKSNE
PVPHNEAYVSRNHGRDWTALDLYVEKCIFGRDVNFKIDEDVIFCSAYNKNDVDAGLRLVR
TRYLAETTDVYFENLVEFFVVEDFMAVASSHKGELALYVSIDGTEFSEAKFPPDEYVNRM
TFTVLQSTTHSILLNVFKTLGYGRSSGALYKSNENGTFYHLSLDNTNVDGVGYVDFEKFQ
NLDGIILANQVWNADELVSNPDKLKKVRTMISWDDGGSWQPLAPPTNIDCDTKECTLNLH
SRTDIHGMGAIFSSSGAPGLAMGVGNVGPALTEYTESDTFLTRDGGHNWIKIRDGEHFYE
FGDQGSLLVLVTDEKPTNELLYSWDQGSSWHSYQFADDPIRVKTLTTDPKSSTLKFVILG
HSRLGERSPVMVTVDFTHTNQPQCVMQENNEEKSDFERWTPKDDENDDACLLGKKTAYWR
RKKDRICKVNAQFHEPQTILENCECRDIDYECDFGFWRDETGNCISIGPHPDRPPTCQPG
SKFKGRSGYKKISKSSCTGGIDLKGDIEWDCGEKGSIISSTFAFTDRVVDYIYFSDTDRV
IVRTMDGKVWRSDNDGYSWRELFEGHRIISMYQNPHFDQRTYFITEGTTHFMTTDKGANY
VEMKVPVGPLLNLQGTIMNFHNDDPDYLIYVGEKNCQGGFGSSCHSEAYYSHDNGRTWSS
LGTYVRNCIWGREGSIKDTHRNSIFCEQYREQSGNQMALFGSSLQFISSQDYFHNKKVVL
ENIVGVTVFGKYMVVAASKNGGANLQLLVSLDGNTFATARFPADFDLSTENANRNEMGIV
DFEKMQGIEGIAIANIVTNSNQANRGDHKILSTQMTADAGGHWHPIQAPKRDSNGNAYSC
PRDACFLNLHCYSERQNSRDLFSLSSAVGLMVGVGNVGDRLSNYRDGDMFLTRDAGKTWT
EIAKGAHLWEFADQGSLLILADNEQPTNSIKYTMTEGLSWNTYEFTTKSDRVIIEDIITQ
PDGTSQKYVLFGLKGGKTIAIHIDFSPLRPNQCVLDLDNPNNDDFELWSPEDTRGEKCLF
GRETAYFRRIRDHDCYVGTKLIQEKVIRNCACAEEDFECDYNYVRDSNGKCVLVPGLSPL
VPKCDGTIDHYYTPSGYRKIAASTCEGGDELDKLGEKVMCPNARRSSGSGGGWVAFLLLP
LFGAGIIFAVLYYRKRGSFGRIRLQDGTHQLRSNILSSPLITKMAAAAFVIPVAIIGILS
RIPIPRSLSDITGMFSNIRLPSFLSRSRGAGYSALGQDEQTDVLLQDYDGSEEHLIDDDE
LDDADEF
Download sequence
Identical sequences I1BNK3
RO3T_02486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]