SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_02080 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_02080
Domain Number 1 Region: 29-178,212-262
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.45e-36
Family Phospholipase D 0.039
Further Details:      
 
Domain Number 2 Region: 306-439,560-640
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.75e-25
Family Nuclease 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RO3T_02080
Sequence length 768
Comment | RO3G_02081 | Rhizopus oryzae hypothetical protein (769 aa)
Sequence
MTFFSDIAEKVSHLFDTPPDEPKKEDDDYIEQQLMNEKHRYDSFAAVRHGAQVKFFVDGQ
NYCWAVSEAIEKATECIYIEDWWLYLRRPPAKYPEYRIDRLLKKKADEGEVELAMTLDSA
HTKDVLDNLGENVTVLRHPDHSLGGTFFWSHHEKFVVIDNQIAFLGGIDLCFGRWDTHGH
PLADFHGNNPDSELFPVKDWDMRLIDKTTIPRMPWHDMSMCVIGAPVLDIARHFCERWNF
IKHEKARHDENIPYLQPPLGGMGSQQRYIEEKTEEPYRYRKYRHNHRTRGVTGTMRVQVL
RSSAKWSSGIELEHSIQNAYIATILGAEHYIYIENQFFITATEMDQDGILKNQIGNAIVH
RIVRAHEEREKFKVFVLMPLMPAFPADLSTKDAATARLVMHYQYLSICRGPNSIVEKLKA
TGIDPDEYIRFYSLRNYDRINRSKLEALLVKAAGYSDETEQQLDNVEGHEGEEAQIVHHA
GDPDFARDTKGAFKVDEEVEYGRVPDEDDVRRYREQFDESIAADSIAKDAMEGGDLEDEP
WVNDTKTSRPRDEEAEREEAGDYVTEELYIHAKLLIADDKTVIMGSANLNDRSQCGDRDS
EIALIVEDKDVIPSQMNGRYYEASRFAATLRRNLWKEHLGLIADMPPDEVTDAMLPLPTP
QIDTTNSKEDKMVMDPLDEETLNLFNSTAKTNTLAYRHVFHCVPDDTDPSQIDIGHVHDP
EMSVEEIRDHLADIKGHLVEFPYHFLENVDLQGESIPFIGNDIQELYT
Download sequence
Identical sequences I1BME7
RO3T_02080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]