SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_04860 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_04860
Domain Number 1 Region: 232-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.22e-31
Family PDI-like 0.0071
Further Details:      
 
Domain Number 2 Region: 20-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.88e-24
Family PDI-like 0.0072
Further Details:      
 
Domain Number 3 Region: 336-449
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000278
Family Thioltransferase 0.056
Further Details:      
 
Weak hits

Sequence:  RO3T_04860
Domain Number - Region: 439-528
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000615
Family Thioltransferase 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RO3T_04860
Sequence length 619
Comment | RO3G_04861 | Rhizopus oryzae hypothetical protein (620 aa)
Sequence
MRIFKVTGLGIGFLTATIQAVSVELRTDNIKAHISSGQWFIEHFSPWCIHCKQFAPTWEQ
LTEDFGHFAKEKDFHFGTIDCSVQGDLCDEHDVSGTPEMQLWNAGQKVEKYTESREYDVL
AEYIKKKANAYSENNSLGDEEEIFENEEISEEGENDINEEQENEEENDLNEEEAEDEEGS
EEDEEEPEDVEEEIDEEAEEIEEKVVMKPDEKAQQTEETTEKALPNPLGISVDLNEKQMK
EVLSKPSDVWFIKFYAPWCPHCQALAPTWEALASQLQNEVNIGEVNCVDHGDICNEHGIE
GYPTLLLFGNGKPINYNGDRSLMSLINFAKANAGPVVKQVNMGELEKYVKAKDVSLVYLS
NNKEIPELIERAARTYMNTVSFYATEDANVFKAYSVGYSDLPAVMVLKDGKQKMYTAHDF
KDTESNEKTLFDWIEKEQYPLVSKLNPSNYQSILEGKKPVVLNIINAQDTVSQTRFHKAA
IAWDRSSQGDGAIFAEMDHAMWGQYVRDKFNVEHNNVPKIVIYNTATSEYFDKDVKGVEL
SSENPEGIYLILENLDRLRGSSALAVHEKVFNSVQSGFHAVGKHWFISIILFSVLGSYLY
KHSSNHRPKKAYILPSHND
Download sequence
Identical sequences I1BVC6
RO3T_04860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]