SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_12924 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_12924
Domain Number 1 Region: 14-68
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 100-200
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000759
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RO3T_12924
Sequence length 476
Comment | RO3G_12925 | Rhizopus oryzae hypothetical protein (477 aa)
Sequence
MKVLKHEFLLLKREAGVIWEQELYNNFEYAQDAPFFHSFETDDCLTALEFVSKEEAETFY
KKVQNRQSLSSKVSSTDNDALKKDKRKSRIDKNHIGMPADFRHISHIGYTPGGGFSVKNN
NDSEMKGILDQLQALGISEDEINENQEFIQDFLQQKNQPQQERAPLAPLPNLNQRKKAPP
PPPPPGRHHGTPPPPPPPRRPNNVNSNGHAASPPPFRAPPPPTPSRGRPAPPPPPSRNVN
SNSAPIRPPTPSYIPTLPQPPHLSNHVPAAPVRPPVYNSIPIPPPMPNNVPPPPVPSGIP
APPPPSVSSAVPTPPPPPPVSGGIPPPPPPPPPMPNAVPAPPPPPMPSSVPAPPPPPMGR
MGAPPAPPGPPGPPSSAPPASVPPSSDGRSNLMASIRAAGGFGTLKSSGKLKQASVSDRS
VPLSDSSATSTAAGAATGAAAGAAGGDLASSLANVLKQRKQAMQSDDEDDEDDEWE
Download sequence
Identical sequences I1CID4
RO3T_12924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]