SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RO3T_13038 from Rhizopus oryzae RA 99-880

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RO3T_13038
Domain Number 1 Region: 680-865
Classification Level Classification E-value
Superfamily Sec7 domain 1.03e-67
Family Sec7 domain 0.00000376
Further Details:      
 
Domain Number 2 Region: 45-166,428-551,1205-1533,1726-1789
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000101
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RO3T_13038
Sequence length 1796
Comment | RO3G_13039 | Rhizopus oryzae hypothetical protein (1797 aa)
Sequence
MSSPAASSQNLSSPRTSSVASSNVFVINALEKISNSKEARRNKSLKEAVSTALNMLKNNE
PAPEGQTRSSVILIALQAAIDTRSANLMTISLDCLGKFITYNYVADMEDEVAQTQVMEKV
VDGICDCFIGEETDKKVQLQIIKALLDAVYSTSNPLHLSALLKAVRTTYNIFLLSRNNDN
QSVAQITMTQMVDHIFRRVKLNPNVPPKQEEQQQQQQQQQEEQQEEQQQQEVKENGTGEV
EENSENVQMETEDYQQQIIVEANMARTEMNHKLPSGKNSKDNYQDILKDTANMFQEEEEN
AVNAGTSDMAADRNDHSQNSTPTILNHDEQAASDNRGSFENEGIQKEDSETEADLYIKDA
ILVFRALCKLSKKSIHSEWGNDMRSYSMRSKLLSLHLILTIMMSHMDVFTSSQIFFSSAV
PDSNGHRSNPFILEIKQYLCPSLGRNAFSVVPQVFDITHEILWIVVQGLRVYLKNEIEIF
FKEIVLKILEMRNASNRQRFSLLRGLLRITEDPQTLVDIYINYDCDGEALDNIYERLVHV
LSKITTSHQHQVPNGKDYDHTPPEAAGTQHSSIHAHSVVIPPPLTTATILHNDKQIQTTA
MPESAIRFKSLECLVAVLRSLVGWYTNNSVSITAGAAKKDEDTPRESEDQLGSMVERLSS
SNESSSALSNNNSNSRLDDPETFENSKHRKQLLQEGIRQFNWKPKKGIAFLSEHGFLGNS
DPRDIAIFLLNTDSLNKTVIGEYLGEHEAENVAIMHAFVDEMDFSDMNFTDALRSFLQTF
RLPGESQKIDRFMLKFAERYVHGNPSVFASAVIMLNTDLHSPQVKRRMTLDDFLRNNRGI
DDGADIPRELLEGVFEEIQNNEIKMKDEVEAANEAALVTSASPGVLGMSGIQNALVNAGI
TRDVRREAYQAAIEEMGSKTEALFRSVLTSRRRAGENDTITFYSASHVEHIRPMFEVAWM
AFLAGISAPLQESDDLDTVNLCLEGFKHAIRIICLFHTVQSEDVDLQRDAFVTTLTKFTF
LTNLNEMKPKNVEAIRTLLEVAAVDGNYLKGSWKEILSTVSQLERFQLITSGLDTGHAAD
AVNYRRQASVDIGRRTSTMGTRSRMISSGRTNTQLSLTEEVTTASSSQSLVLAVDRLFTS
TVNLNGDAIVDFVRALCEASWEEIVSSAHMEHPRMYSLQKLVEISYYNMNRIRMEWSNIW
AILGEHYNKVGCQSNFNVAFFALDSLRQLAMKFLEKEELPHFKFQKDFLMPFREVLANNP
DVAIKDMVLRCLSQMIQARPHHLRSAWKTMLSVFATGACETSESIVHMTYDIVRSITNER
FGDIVANGTFPDYISCLVEFSKNKKFQKISLPALDMIKATIPKMLDVANTSEEVTDGQTN
NKDDFLVKFWFAVLYGLKEIVMQSDDVEVRKRALEYLFETLKKHGSSYTAEFWTTVTRQI
VFPLFDDLKNGANGRRQMSAEDYSVWLSTTMIEALRNVVDLYTFYFDNMREMMVHVLNLF
SMCITQDNDTLAHIGCECLDQYIKSNVEKFDESCWTLVTESFKELFEKTTAYGLFDDTTD
LVDKVKRLSAGAQNGDSNEVSLSAEVSDERQTKFQQVIVKCVLQLMLIQTVNDLLAKDVV
YCAYPALHLMELMGCLGKSFHFAKKFNMNNDLRMALFRFGFMKQLPNLLKQETSSGGCYV
SVLMRMYANLENIDDRDSQKEEIENILIPLCNEIFTLYAELDHETKPKNIAAWTPVVVNI
LNGLAQLQDEDFLKHVPQFYSPSVELLGQENLLSEIRLALRTLLIRIGKSYHITKV
Download sequence
Identical sequences I1CIP8
RO3T_13038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]