SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|86359559|ref|YP_471451.1| from Rhizobium etli CFN 42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86359559|ref|YP_471451.1|
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.37e-34
Family Thioltransferase 0.0019
Further Details:      
 
Domain Number 2 Region: 157-285
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000514
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86359559|ref|YP_471451.1|
Sequence length 324
Comment thioredoxin protein [Rhizobium etli CFN 42]
Sequence
MSGSNNPYNGSFGNQMSATASFGAQPEPAAAAGSYITDTTTANFGKDVIEASRNQPVLVD
FWAPWCGPCKQLTPVLEKVVNEAKGRVRLVKMNIDDHPSIAGQLGIQSIPAVIAFVNGRP
ADGFMGAVPETQIRQFIDRIAGPAGADEAAEIEAVLTEATEMLAAGNINEAAQLYGAVMQ
ADPENAKALAGMAECMIAADQHQRARETLTDLPEELAKDAGIQAVLKKLDQIEEARKLGD
PVALERELATNPDHHEARLKLAKILNVEGRREEAAEHLLLIMRKDRGFDDDGARRQLLQF
FEVWGFKDPATVAARRKLSAMLFS
Download sequence
Identical sequences Q2K362 S5S0X6
347834.RHE_CH03979 gi|528830756|ref|YP_008366712.1| ReR13 gi|86359559|ref|YP_471451.1| WP_011427168.1.62937 WP_011427168.1.76939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]