SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM07076 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM07076
Domain Number 1 Region: 10-202
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.66e-35
Family RNA methyltransferase FtsJ 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM07076
Sequence length 214
Sequence
MQILFRRCCYSTSSKGWIQRQARDPYVKAAKANQYRARSAFKLLQLDNKYKLLRKGNVVI
DCGAAPGGWTQVIAQKVRDKGLVVAVDLLPIEPIPNAHIIKGDFMDLQVQTKIQTILDGR
PVNLVCSDMAPSFTGNHFADHARSMSVLAPGGAFVAKVLMGGEEVQFRQKLKTMFSMVKQ
EKPDASRKKSTEVFLVATGYKNGQQSNSDGSNSS
Download sequence
Identical sequences RhzM07076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]