SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM09708 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM09708
Domain Number 1 Region: 16-173
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.4e-21
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RhzM09708
Sequence length 228
Sequence
MLANIVANHEQVAAGSADKQLQTRMSFDDGSTWAPIKRVKGLDGNDLPCSEDECALHLHS
ISSPHNAGEVFTSRSAIGVLMGVGHYGRYLLEYDECDTFLSTDGGITWKMAREGAHKYEF
GDMGALLILVDDEKEVDHVWWSKDRGNNWNKLDLGVNIRARILTTDPESTSRNFLLIGSA
RNADTHIVSLHLDFTGVQDRQCQLIENDEEKSDFEKWYARDLTEGPDC
Download sequence
Identical sequences RhzM09708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]