SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM09709 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM09709
Domain Number 1 Region: 119-251,308-367,430-575
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.33e-40
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 934-1007
Classification Level Classification E-value
Superfamily Translation proteins 4.24e-18
Family Gar1-like SnoRNP 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM09709
Sequence length 1091
Sequence
EETCECRDVDFECDFGFWRNEQGECTYYGRHPDRPTQCDPKDKFKGRSGYKKNPKSSCSG
GINLEEEKEWDCGEGGTVQSTKMEFSDRVMDYIYFTDTDVRTISQCDMTITILTERYLQR
VIVRTADGKVWASENDGASWKELFPGANVVAVYQNTHHEDRAYFITDGLVHYVTQDKGSN
FQEMAVPLVPLMNLQGTVLSFHNSEPDYLIYLGESGCDSFLSGDCHSEAFYSHDHGRSWH
SMGTYIRSCIWGREGSIDATDYHSVFCEQYHDLSGNQKSFFNNRVQFVSSTNYFSDKRVI
YEDVAGVTVFGKYMIVAVSNNGGATLRLAVTLNGETFADASFPANFDLSPEAFTIMESVN
SLWIHVSTNTHRGSEYGNIFTSNSNGTYFVLSLENANRNEIGIVDFEKMQGIEGIAIANK
VTNPGEANVGNPKKLMTFMTADAGGHWVPLAAPTKDSEGKDIKCKEKDKCNLHLHCYSER
RNARDLFSLSSAVGLMVGVGNVGDHLTAYQSGNMYLTRDAGKTWFEIMKGTHLWEFADQG
ALLILVNDNEPTNVLKYTTNEGLSWNTYQFADKSEKIRVEDIITQPDGTSQKYVIFGVES
GSGKFVGYHVDFSALHPTKCKLDLSNPENDDFELWSPEDTRGEACLFGRETKYYRRIRDR
DCYIGEKLVQPHEEVRNCTCTAEDFECDFNYVRDDNNQCILVPGLSPLIPECDGSMDFYY
MPTGYRKIAGSTCQGGLTLDQGDKRWCPGKAHSGGMWIVYVFAPIGGAAAIYACLHYRKH
GRLGRIQLPDATTTQTSRIMSHPILTKVVAAAVVIPVAIIGLLARIPIPNSFADLKSMVQ
NVSLPSWLTRRRGGYSPLGQDEHATDVLLDDYDGSEAQLLDEAEEDADELFELIEMGKGG
FGNRGGRGGARGGRGGGRGGFQGGAPQGPPAEVVPMGQFVHACEGEMVCKSINTKIPYFN
APIYLENKAQIGKVDEILGPLNEVYFTVKVQDGIVATSFKPDDKVYISTDRLLPMERFLP
KPKVVNTGSKPTGLQGKVEKRSGRGGGRGGRGGGRGGARGGARGGGARGGFRGGGRGGGR
GGFRGGRGGAR
Download sequence
Identical sequences RhzM09709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]