SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM01822 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM01822
Domain Number 1 Region: 27-181,215-265
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-42
Family Phospholipase D 0.035
Further Details:      
 
Domain Number 2 Region: 288-436,536-617
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-21
Family Nuclease 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM01822
Sequence length 735
Sequence
MVTPHQVQHKVYKLINHEENEDEREHKYQTTFHRFGSFAPVRHGAQVKFFVDGHDYCWAV
SEAIENARHVVFIEDWWLYLRRPPSKYPEFRIDKLLKRKAEQGVKIYIVVYKEVELAMTL
DSKHTKDALQSLHENIIVQRHPDHAIGGTFFWSHHEKFVVVDNRIAFLGGIDLCFGRWDT
HNHALADFQGPKPGDEVFPVKNWSMHLVDKTVVPRMPWHDMSLCMLGGPVLDVARHFCER
WNFIKHEKAMDKDNVPFLRPPLGGFAGHQRFQIPDENEHYHHHRYSHDTRGVKGNVRCQV
LRSVGEWSLGTDTEHSIQNAYISTIHDANRLTAISNYTVTATEEKDDNVLKNQIGQAIVK
RIIRAHEEGEPFKVFVLMPLMPAFPADLSTKEAATARLVMHYQYISICRGSQSIIEKLKA
AHIDPDRYIRFYSLRSYDRIHRRKLEEMLARAAGYSANVEPSVEEQVASTEIGERDDIPV
TVKRSQEVFRAEECIAKDIISDNAMQGGDIKREAWLVDTPTSQPRDLDAEKIERDGYVSE
ECYIHAKLLIADDKVVIMGSANLNDRSQCGDRDSEIALYVEDQETIPSQMNGHYYEAAKF
AATLRRQLWKEHLGLMPPQDLDTVNNAMLPLPVPQIDHTGTKEDRLVMDPLSQESLALWN
NTARINTEAFRNVFHCVPDDSGHVYDPEMPVDVIREELSKIRGHLVEFPLHFLENVNLDG
ESIPFIGDTVQELYT
Download sequence
Identical sequences RhzM01822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]