SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM02683 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM02683
Domain Number 1 Region: 27-179
Classification Level Classification E-value
Superfamily PEBP-like 2.35e-24
Family Phosphatidylethanolamine binding protein 0.0034
Further Details:      
 
Domain Number 2 Region: 182-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000145
Family Glutathione S-transferase (GST), N-terminal domain 0.019
Further Details:      
 
Weak hits

Sequence:  RhzM02683
Domain Number - Region: 257-401
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000383
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM02683
Sequence length 492
Sequence
MLFTKALLVFSSALAAWALDPTKIKADLSKAKIIPDVLDDFDVASELRITYHLTKQLSMG
TSMTAAETETPPHVWFPKTNEESQYTLVMFDADASRPLTRQWIVTNIDGQKPGTSVADMS
DLHQYTRYQPVPQDSQTHRYVFALFEQSAVNQTFVPPIKDLPEDRSGFDIKEFATKNNLK
PHWYPLSPFAQKVAWVLNYKNVNYKTVQISPIEPRPLRRPLDGSYRKTPILQIGNKVYCD
SKRIFAEIERRFPEPSLYPKTKTGQPTLALCQALSHWTDNKLFMAVPTQFPLELMPRPFL
EDRAKFAGSANVFDVEKSKVLGPLLRAELHARLLQAQALIGDKPWILETEALSAADLHVA
FVTFFALNVLTHEWMKKHVPELVNHFERVKEAIRFARTEEMPKITAEEALEVAKRAPTTY
SVPDPTSCSPALKVGQMVSVTPLDSGKVPAVGKLLSMTLDEVILERRDEQTGIVAYIHFP
VIGFIVAPVSKL
Download sequence
Identical sequences RhzM02683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]