SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM04693 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM04693
Domain Number 1 Region: 133-501
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 8.26e-70
Family Hypothetical protein YteR 0.074
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000895
Family Thioltransferase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RhzM04693
Sequence length 651
Sequence
MEHESFEDKQVVKIMNEHFVNIKVDREENPGVDRLYMTYVQLVSGRGGWPMSVFLTPKLE
PFFGGTYFPPSDHQGSPGFRTLLERVAELWAAAPDKLTESAENTIAQLKAFSEAKTALSV
DDIDPNAVAGNALKHFEESFDSEYGGFTGAPKFPTPVQIQFLFDYYGYMKQQKETLDKAQ
EALDMALFTLRKIALGGIRDHIGSGFHRYSTDKYWHVPHFEKMLYDQGQLLSAYTRAYQI
TGDEGFAEIAKDIITYVARDLHHHEGGFYSAEDADSLPSQDATKKKEGAFYVWKAEELEM
ILGSEAARIVSTYYGVQKSGNVNPAQDPHGELKGENVLAEEKSVNEVAKELYLSVQTVGS
IISESKAKLLKYRKEHRPKPHCDDKILTSWNGLMISGLAHAYQAFQDPRILELAKGTAQF
IHKKLYQPDSKTLLRSYRLGPSNIEGSLEDYSFLVQGLLDLYEATFDEHYVSWAWKLQEK
QNELFYDGSKGGFFMTPQSDTKQDGAEPSANSVSLRNLIRLGTILEQESYVTMARQTVAS
FGATFNQFPYAMPTLTSSFMLMGHGVKQIVLTGEPGDQELPKFKQIVSKAFVPNKIVVLA
KKDGIIAEKNNIVGQLAVKAQGEPAAAHICEHFTCGLPIKDVQQLRKEIMD
Download sequence
Identical sequences RhzM04693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]