SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM04884 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM04884
Domain Number 1 Region: 142-523
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 9.83e-70
Family Hypothetical protein YteR 0.088
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000671
Family Thioltransferase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RhzM04884
Sequence length 667
Sequence
MESWCHVMEHESFESEDVASVMNKHFVNIKVDREENPGVDKLYMTFVQFTSGGGGWPMSV
FLTPDLQPFFGGTYFPPDDRMGRPGFKTLLLRIAQLWASRADKLKASGQKTIMQLKKYAE
ASPAQSSGALDPWDVAKETFEHFEGSFDAVYGGFGSEPKFPTPVQLEFLLNYYGYLRRDK
AISETANQALEMVVFTLKKIAAGGIHDHVGNGFHRYSTDQKWHVPHFEKMLYDQAQLLSI
YCQAYQITRDEEFATVAKDIILYVSRDLQHSEGAFYAAEDADSYPTEQSDKKKEGAFCVW
TLSELQNILGEEVAKVFAYCFDVHAMGNVDPHKDPHGELNGKNVLTRHYSDRETASHFDM
EEEQVKTMIQNALQKLWNYRSTNRPKPQRDDKILTSWNGLMISGLATAYRVLQLNDALEL
ALKAARFIRKELYNADTNTLLRSYREGPAKIEGFADDYSYMIQGLLDLYEATFDEYWVQW
AYDLQQRQDELFYDTAGHGGGYYNVPDTDKSILVRLKEEQDGAEPSANAVSTRNLCRLAS
ILGDEEYLQKARSTIDSFQTALKRFPFAMPAFVHGLLLTATGVKEIVLAGADENVKEFEQ
AIFVAFLPNKVVVRARPQKGDGFIAGKNKVIQDICQRAKEEAEVYICENFSCGLPISDIA
TLESKLN
Download sequence
Identical sequences RhzM04884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]