SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RhzM09758 from Rhizomucor miehei CAU432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RhzM09758
Domain Number 1 Region: 198-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.95e-38
Family UAS domain 0.0000701
Further Details:      
 
Domain Number 2 Region: 366-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000031
Family UBX domain 0.026
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily UBA-like 0.00000281
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RhzM09758
Sequence length 619
Sequence
MDNEQAILDFCTVTGASTDVAQDYLQIADGNVETAVTLYIESGGQSVSQSSARPTTSTAG
SSPRSTGENLIETDEEIARRLQQEERGREQVRAPIAPRRDILTGGGSPFEHSSLWGSPAN
SSRTRHPFRSVFNQGDSYTGSPGPDFLRNLEAVLIGSKQFLGSSSSTIAGNFEDTSQITA
KAKRLADQDQRPARLVPRHVRLFRPPFDIMFKGGFEEARASAKEQTKWMLVNIQDQTEFS
CQVLNRDLWSDKIVKEIIRESFVFLQYDCQSPEGKRYATLYPIKKYPHISIIDSRTGERV
KTWEKMMSPTDFVMDITEFLEQRSPDGPQVATFQNVSDMSEDEQIKAAIAASLGNSGSEE
AEVVRESSQKPTAEAEEEEEAEASEASKLDTIQPIKRDEPTDMANSTRIQLRMADGKRVI
RRFMKTDPVQYLFEFVKAEFPEAQTRPFEASLWSNMCLWRNRDSCSHGFVYIAGFQSETI
NRGVGSADCRSRFRERSRESCVPAHVSSIELAFFTFRLFFSRLVLGGVLVCRLSSCSPPS
LWVAVFEPTLFYGGCPTLPPPPPGGGVGFGLRALGRVLLYRLAGRVSVFDGVKQCQVRLS
EYKILGLCRLALRWIHCSS
Download sequence
Identical sequences RhzM09758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]