SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29829458|ref|NP_824092.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29829458|ref|NP_824092.1|
Domain Number 1 Region: 11-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.62e-30
Family GHMP Kinase, N-terminal domain 0.0007
Further Details:      
 
Domain Number 2 Region: 173-289
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.91e-28
Family Homoserine kinase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29829458|ref|NP_824092.1|
Sequence length 305
Comment homoserine kinase [Streptomyces avermitilis MA-4680]
Sequence
MAGPAFRAAAVRVRVPATSANLGPGFDALGLSLGLYDDVVVRVADSGLHIDIAGEGSETL
PRDERHLLARSLRTAFDLLGGQPRGLEIVCANRIPHGRGLGSSSAAICAGIVAARAVTIG
GDGKLDDTALLELATEIEGHPDNVAACLLGGFTLSWMEGGAARAIRMEPADSIVPVVFVP
GKAVLTETARGLLPRSVPHVDAAANAGRAALLVEALTRRPELLLPATEDRLHQEYRAPAM
PESMALVERLRADGIPAVISGAGPTVLALADEASADKVARLAGEGWAANRLSLDARGASV
LPLAA
Download sequence
Identical sequences Q82J66
227882.SAV_2916 WP_010984348.1.19017 WP_010984348.1.49792 WP_010984348.1.60620 WP_010984348.1.68722 gi|29829458|ref|NP_824092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]