SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29833900|ref|NP_828534.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29833900|ref|NP_828534.1|
Domain Number 1 Region: 1-385
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 9.42e-72
Family Gtf glycosyltransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29833900|ref|NP_828534.1|
Sequence length 397
Comment glycosyl transferase [Streptomyces avermitilis MA-4680]
Sequence
MGRFLFVVPPLVGHVNPAVGTAAALAARGHDIAWAGHPELVRGLAGADAVVFPCALPEDG
LSRPAGLKGPAAFQFLWESFLVPLADAMAPGVRAAIEAYDPDVVVCDQQAVAGALVAESL
GRPWVTSATTSAELVDPLAGMPKVAAWLDGLLGELRRRITGGAGAADPRFSPHGVLAYTT
RALLGPVELPDRVWLVGPSVAARPAGPDDFPWEWLEASALPTVLVSLGTANNDAGARFLN
AAAEALGGIADRVRAVLVDPGGVVEHPVPDTVLVRRYVPQLALLERLDAVVCHAGHNTVC
EALWHGVPLVVAPIRDDQPIVAAQVVDAGAGVRLRFGRADAARIGAAVEAVLDPAQGHRK
AAEAVGESFRAAGGSESAADRLETLTAESAVPGVRGS
Download sequence
Identical sequences Q825U1
gi|29833900|ref|NP_828534.1| WP_010988753.1.19017 WP_010988753.1.30226 WP_010988753.1.49792 WP_010988753.1.60620 WP_010988753.1.68722 227882.SAV_7358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]