SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29830757|ref|NP_825391.1| from Streptomyces avermitilis MA-4680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29830757|ref|NP_825391.1|
Domain Number 1 Region: 13-37,73-231
Classification Level Classification E-value
Superfamily Prim-pol domain 6.34e-34
Family Bifunctional DNA primase/polymerase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29830757|ref|NP_825391.1|
Sequence length 305
Comment hypothetical protein SAV_4214 [Streptomyces avermitilis MA-4680]
Sequence
MATTDRQATTLALAHALSAAERGLAVIPLSRTKLPALRSPHRATSDRTPSDRGTPRHDVP
GPTAPVCHGECGRFGHGVYDASTDPRRIRRLFAAAPWATGYGIACGLHPHFLIGIDLDTK
SGTDSSAALRELALRHLFTIPDTVVVLTPSGGRHVWLSGPPDVVVPNSAGRLAPGIDIRG
AGGYLVGPGSRTRHGVYSTAPGTARLAPAPCPTALLRLLTPPPRTHHPTPPATGEHGQGL
VQFVLAAHEGQRNTRLFWAACRAYENGIGPDLSPALIDAAVHTGLSEREARSTLASAARM
TGRRP
Download sequence
Identical sequences Q82FN8
gi|29830757|ref|NP_825391.1| 227882.SAV_4214 WP_010985641.1.19017 WP_010985641.1.30226 WP_010985641.1.49792 WP_010985641.1.60620 WP_010985641.1.68722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]