SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433589603|ref|YP_007279099.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|433589603|ref|YP_007279099.1|
Domain Number - Region: 346-377
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0565
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433589603|ref|YP_007279099.1|
Sequence length 449
Comment transposase [Natrinema pellirubrum DSM 15624]
Sequence
MRRVNTFEIRPLSERDEILLFEILDASASLWNELTYRRRQAFYAGEDIWQGDTGRYRSKY
KGTIGAAAVQQVIRRNDEAWRGFFGLLEEGSDANPPGYWKDDEQRKLRTLVRNDQYTLEW
GKRSRLEIPVGLDLKEKYGLGYNERLRLEARGDPRWTGKGGRLGLVYDRDTDSFRARQPV
ENATRRRRESLATVSSDDDAVAALDIGANNLVAVTTTRGDQLLYHGRPQFHRFRRTTERI
ATLQSRLGPEKWTSRRIRRHYQQRSDRRNHLQDALIRDLREWLRDRNVSSVIVGDLGAFS
SHWCARVNEKVHLFWAYGRFQRRLREVLQGEYGIDVREVDESGSSSQCPRCGGQNINRCK
DTFQCRECGFEGHSDVVGSENLLFEHTDCGSMARPAAPDQNRSGEGHREVPRLEWDDHRW
QRRDRSTKENPVNRSTWNGKFAAGESGTA
Download sequence
Identical sequences L0JF85
WP_006180432.1.15549 WP_006180432.1.24189 gi|433589603|ref|YP_007279099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]