SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433589831|ref|YP_007279327.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433589831|ref|YP_007279327.1|
Domain Number 1 Region: 151-225,266-437
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000641
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433589831|ref|YP_007279327.1|
Sequence length 442
Comment hypothetical protein Natpe_0493 [Natrinema pellirubrum DSM 15624]
Sequence
MATHDERSSDGFLPFFREYTKTWIHAVAAAGLTAFGTLSVYHRAFIALALASYVVPPIAL
YLWRPSAGRDAATDRASEPSAARDRAATTADRAATGDTALERPDVAAESADRDGHDGVAL
GSDDDRPDVDTSGGASGTDAASETRRPHVREWRPVDVPTEATLRDVCVTDGGAAHAVGED
GVVLSATGGDTEWSVALADGPAAQGEELQGVDATADGAAVWIAGDSGAVGRLEPETGLHT
DYTAPLEITNNWLGVAVAGRSGDETVLLIDGSGAVLRGRYRDGTIGWDEPVTPGSGSSLS
GVALADSAVGYCCDTNDAVFETADGGASFDRVGPVGAGGTLEAVATLGRGDCLVSADDGV
VHRYGGSTWTPERVSEEAICGLARREGEAIACDADGIIYERGGADWDAVDTGPLESLIAV
AVAPDGRRAVAVGDEGTVVERR
Download sequence
Identical sequences L0JHV4
gi|433589831|ref|YP_007279327.1| WP_006180180.1.15549 WP_006180180.1.24189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]