SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433590684|ref|YP_007280180.1| from Natrinema pellirubrum DSM 15624

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|433590684|ref|YP_007280180.1|
Domain Number - Region: 357-384
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00233
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433590684|ref|YP_007280180.1|
Sequence length 430
Comment putative DNA-binding protein containing a Zn-ribbon domain [Natrinema pellirubrum DSM 15624]
Sequence
MTVVGIDDTDSRERGMCTTYLAATIADRLQRDHGAALARILLVRLNPAVEYKTRGNAALA
IHTDCDPDTAAAVARDRLEALSETADERTNPGLVVADHDPGDVADTVSRFSRAAIRDHLA
IDDAVALVDDCGYRSWHAGDGRGRIGALAAVGAWAALEEWTYEYITYREPDRWGTPRDVD
HDSVFAAADWGYPAVWDTVDRGEDETVCVPHTPGPILHGIRGDDPDAVRAVADRIAAEPA
ASSQLFVTNQGTDVHLRDGSIPEVRDGRAYRLPGRVASEPETRRGGHVFVDLEPPEVGES
AATERLTCAAFEPTKRFRDRVRALRVGDRITACGEVADGTLKLEKLAVRDLVRTERVTPT
CPDCDRRMKSAGRNQGYRCRDCGTSRDEKATRRLERDLERGWYEVPPCARRHVAKPLVRG
GFDAPTHPER
Download sequence
Identical sequences L0JLP9
WP_006179526.1.15549 WP_006179526.1.24189 gi|433590684|ref|YP_007280180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]