SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|377811381|ref|YP_005043821.1| from Burkholderia sp. YI23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377811381|ref|YP_005043821.1|
Domain Number 1 Region: 37-234
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.48e-44
Family Phospholipase D 0.018
Further Details:      
 
Domain Number 2 Region: 278-456
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.92e-28
Family Polyphosphate kinase C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377811381|ref|YP_005043821.1|
Sequence length 519
Comment phospholipase D/transphosphatidylase [Burkholderia sp. YI23]
Sequence
MKLRSWLIALTLLMTACASLPPQSARVQTHALTDTANTRLGAAFASSEAAHPGDNAFHLL
IHGMDALIARVILSERAERTLDLQYYIWHDDLTGREMAASIMRAADRGVRVRLLLDDLGT
NADDQFLLALASHPNVQVRLFNPVANRTFKRLGSAVEFFRVNRRMHNKALIADNQAAILG
GRNIGDEYFGASSTVSFGDLDVLVHGPVVREVSSAFDLYWNSDAAYPIENLMGRKADPDA
LAGYREKLDAYLLSEQHSPYVAQVRERLATVIQAHDTAFSWGKATLLYDDPAKITRAPGD
TEGHLMSQFKALNLEPDTELLIVSPYFVPRKEGVRWLRSMTSRGVRVTVLTNSLAATDVA
AVHAGYQRYRKAMLEAGVKLYELKPVASTDKDKDKTAKKSTFGSSKASLHAKTYVFDRKR
IFIGSMNLDPRSVELNTEIGVYCESEAAASQVADGIGSNIDRIAWRVELRDDGNGGTRMV
WIDTNAQGDTTVLDKEPDVSGLKRAGIWMLGLLPIESQL
Download sequence
Identical sequences G8MNA9
gi|377811381|ref|YP_005043821.1| WP_014252562.1.56761 gi|377811381|ref|YP_005043821.1|NC_016626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]