SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|377812262|ref|YP_005041511.1| from Burkholderia sp. YI23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377812262|ref|YP_005041511.1|
Domain Number 1 Region: 18-248
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.04e-30
Family Nuclease 0.046
Further Details:      
 
Domain Number 2 Region: 267-426
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.28e-24
Family Nuclease 0.064
Further Details:      
 
Weak hits

Sequence:  gi|377812262|ref|YP_005041511.1|
Domain Number - Region: 509-577
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.085
Family Calcium ATPase, transmembrane domain M 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|377812262|ref|YP_005041511.1|
Sequence length 769
Comment hypothetical protein BYI23_B000170 [Burkholderia sp. YI23]
Sequence
MWPTSAGRHMSNAHDDEPFFQPGRNCASVRHADRFSLLIDGADYFRVLREAITRAERTVF
ILGWDIDSRMKLTPEGADDGYPDALGDFLHAVTADKRRLRIYILAWDFAMLYAFEREWLP
VYKMGWRTNRRIAFQMDGKHPLGGSQHQKLVVIDDRLAFVGGLDLTRSRWDTTAHAPDEP
LRRDANGAPYQPFHDVHTMFDGDAARAIGALARERWARACGKRLAIRAHRAKLQQDPWPP
SRRVDLEDAQIAISLTEPAYLGREPVQQIRTQYLDAIARARRSIYIENQYFTSGTVGAAL
ADSLAREDGPDLAIVVPRNQSGWLQEVTMGVLRARLHDLLKHADTHGRYRLMCPIVPKLG
DEIVNVHSKLMIVDDELLIVGSANLNNRSMVLDSECNVSIDAGADARIRRAIATMRDTLL
AEHLGCEIDDVVRERHARGGMNAAIQALLRDREAHRTLVPLDPQVSRELDQLIPPEALID
PETPIAADELVDQFVPAEKTRPLIGRFALLGMLALMVVVVAGLWHWTPLADYVNLKSLTN
ATRRIDALPLAPLWIVLAYVTAAVIAVPITLLIATTGVVFGASWGGVYALTGTTIAAAVS
YSLGNWLGRDAVRKLAGARVNRLSERVAKRGIVAVVVLRLLPVAPFAIVNMVAGASHIRM
RDFMIGTMLGMGPGIILTVAFAHQLIASLHRPTVGSFAVLIGIGSVLIGVSLLLQRFLGR
AEHHDAHEGAPSDADKPRASDEAKRASELRENGTMPRESKNARPDEVNS
Download sequence
Identical sequences G8MCP4
gi|377812262|ref|YP_005041511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]