SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410862972|ref|YP_006978206.1| from Alteromonas macleodii AltDE1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410862972|ref|YP_006978206.1|
Domain Number 1 Region: 7-252
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.85e-25
Family Nuclease 0.051
Further Details:      
 
Domain Number 2 Region: 260-424
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.47e-20
Family Nuclease 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410862972|ref|YP_006978206.1|
Sequence length 738
Comment phospholipase D [Alteromonas macleodii AltDE1]
Sequence
MQSGKSIFQPGQNCWVESKARFSTPLIDCGNYYKALHSSIVKARHSIFIVGWDIDSRIRL
LRGDDEANSEAPSVISDLLKWKAEQLPDIKIYLLRWDSSLAFFAQREMWAKEVWEEKTPD
NVQTELDGTIPMGGSQHQKIVVIDDELVFSGGMDVSTNRWDTRDHPVVSEERDGPDGEYG
PLHDVQMVSSGPVVEDFAKLVRWRWQRVAEESPIDMREDARIDDNAPLPDAWPEDYPPLF
ENVECALARTIPFMDEVEPAQEVRHMLLDLIGEAESVIYIENQFTTRQEIAEALNKQLKL
KPNLSVIIVSSYEPKGKFECEAFWASRIEFKAILEKGIDPERVKLTYSSIEDMQGRRAYK
RIHSKVMTIDNKYLVIGSSNLSNRSMTLDTEIDTVLFGNSKENQACIEQVRNDLLAEHTG
RDIADMPAIFDNDSPVEALMQGQIAHGYVLTEVRDEVFTEHSGQNMFRALSDPEEPLISV
PTFDGAALPARNPRRRSIMILIGLAIIAVLGGLMFWASQSIPWLSSDSINTFLEKSRGTY
FALPTVLLVYVVGGILFFPVTVLSLAVAAIFGPIWGPIYGIMGALMSSAIMFGVGKLSGN
AGLRKIGGPKVAAVDEKLKRSGIVGVAAIRMLPVAPFSLVNLVAGISSIGIFQFLVGTFL
GMFPPMIAKGLVGDSIAQIWQNPSPETISYLVGGIVLWGLMIWGSQKFARFYQARKEAKS
DSENEDSSSKSEVKKCAA
Download sequence
Identical sequences S5C2D0
gi|522615577|ref|YP_008181267.1| WP_015068060.1.24997 WP_015068060.1.30323 WP_015068060.1.68468 gi|410862972|ref|YP_006978206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]