SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512539037|ref|YP_008084541.1| from Streptococcus agalactiae 09mas018883

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512539037|ref|YP_008084541.1|
Domain Number 1 Region: 175-317
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.73e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 41-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000559
Family Glutathione S-transferase (GST), N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512539037|ref|YP_008084541.1|
Sequence length 318
Comment Glutathione S-transferase, omega [Streptococcus agalactiae 09mas018883]
Sequence
MGLLVDGKWVDQWYDTASTGGKFVRTVTQFRHWVTKDGSAGPSGDAGFKAESGRYHLYVS
LACPWASRVLIMRKLKNLESHISISIVNPLMLENGWTFQEYKGVIPDMINQSQYLYQIYQ
ASQSDYTGRVTVPVLWDKKFHTIVNNESSEIMRMLNTAFNHITGNTDDYYPDSLQGQIDE
MNNFIYPKINNGVYKAGFATSQNVYQKEVETLFTALDQLEKHLSDNHYLVGEQFTEADIR
LFTTLVRFDTVYYGHFKCNLKALHDYPHLWHYTKRIYNLPGIAETVNFDHIKKHYYGSHK
TINPTGIIPAGPNLDWTI
Download sequence
Identical sequences A0A0H1ETN7 A0A1F0CHC8 Q8E0D4
205921.SAK_0925 208435.SAG0800 APC61762 gi|22536964|ref|NP_687815.1| NP_687815.1.71890 WP_000523788.1.100254 WP_000523788.1.10029 WP_000523788.1.100367 WP_000523788.1.100766 WP_000523788.1.101222 WP_000523788.1.101267 WP_000523788.1.101296 WP_000523788.1.101830 WP_000523788.1.101853 WP_000523788.1.101956 WP_000523788.1.10371 WP_000523788.1.10618 WP_000523788.1.10723 WP_000523788.1.11465 WP_000523788.1.11756 WP_000523788.1.12166 WP_000523788.1.1251 WP_000523788.1.12619 WP_000523788.1.12688 WP_000523788.1.12755 WP_000523788.1.12978 WP_000523788.1.13008 WP_000523788.1.13064 WP_000523788.1.13285 WP_000523788.1.13384 WP_000523788.1.13553 WP_000523788.1.13737 WP_000523788.1.14275 WP_000523788.1.1437 WP_000523788.1.14738 WP_000523788.1.14953 WP_000523788.1.14960 WP_000523788.1.15417 WP_000523788.1.15526 WP_000523788.1.16134 WP_000523788.1.16165 WP_000523788.1.16342 WP_000523788.1.16595 WP_000523788.1.16706 WP_000523788.1.17339 WP_000523788.1.17489 WP_000523788.1.1775 WP_000523788.1.18047 WP_000523788.1.18450 WP_000523788.1.18829 WP_000523788.1.18841 WP_000523788.1.18933 WP_000523788.1.19892 WP_000523788.1.19950 WP_000523788.1.20188 WP_000523788.1.20326 WP_000523788.1.20791 WP_000523788.1.20847 WP_000523788.1.21522 WP_000523788.1.21525 WP_000523788.1.21669 WP_000523788.1.21722 WP_000523788.1.22139 WP_000523788.1.22247 WP_000523788.1.22801 WP_000523788.1.23380 WP_000523788.1.23384 WP_000523788.1.24441 WP_000523788.1.24475 WP_000523788.1.24845 WP_000523788.1.25781 WP_000523788.1.25998 WP_000523788.1.26029 WP_000523788.1.26056 WP_000523788.1.26258 WP_000523788.1.26300 WP_000523788.1.26357 WP_000523788.1.2651 WP_000523788.1.26791 WP_000523788.1.26827 WP_000523788.1.27024 WP_000523788.1.27958 WP_000523788.1.28021 WP_000523788.1.29020 WP_000523788.1.29163 WP_000523788.1.29238 WP_000523788.1.29352 WP_000523788.1.29719 WP_000523788.1.30062 WP_000523788.1.30252 WP_000523788.1.30603 WP_000523788.1.30703 WP_000523788.1.3074 WP_000523788.1.3112 WP_000523788.1.3166 WP_000523788.1.31888 WP_000523788.1.32520 WP_000523788.1.32745 WP_000523788.1.32818 WP_000523788.1.34227 WP_000523788.1.34276 WP_000523788.1.34467 WP_000523788.1.34475 WP_000523788.1.34896 WP_000523788.1.34906 WP_000523788.1.35216 WP_000523788.1.35428 WP_000523788.1.35443 WP_000523788.1.36095 WP_000523788.1.36408 WP_000523788.1.36977 WP_000523788.1.37018 WP_000523788.1.37098 WP_000523788.1.37523 WP_000523788.1.37570 WP_000523788.1.38578 WP_000523788.1.38699 WP_000523788.1.3880 WP_000523788.1.38842 WP_000523788.1.38910 WP_000523788.1.3930 WP_000523788.1.3937 WP_000523788.1.39386 WP_000523788.1.40015 WP_000523788.1.40359 WP_000523788.1.41269 WP_000523788.1.41399 WP_000523788.1.41646 WP_000523788.1.41663 WP_000523788.1.41785 WP_000523788.1.4215 WP_000523788.1.42225 WP_000523788.1.42844 WP_000523788.1.44371 WP_000523788.1.44374 WP_000523788.1.44712 WP_000523788.1.44727 WP_000523788.1.44746 WP_000523788.1.44957 WP_000523788.1.45 WP_000523788.1.45103 WP_000523788.1.45150 WP_000523788.1.45790 WP_000523788.1.45976 WP_000523788.1.46116 WP_000523788.1.48052 WP_000523788.1.49082 WP_000523788.1.49421 WP_000523788.1.49423 WP_000523788.1.49508 WP_000523788.1.49888 WP_000523788.1.5055 WP_000523788.1.50874 WP_000523788.1.51114 WP_000523788.1.51570 WP_000523788.1.51780 WP_000523788.1.52273 WP_000523788.1.52470 WP_000523788.1.52729 WP_000523788.1.52826 WP_000523788.1.52916 WP_000523788.1.52981 WP_000523788.1.53087 WP_000523788.1.54107 WP_000523788.1.54228 WP_000523788.1.54416 WP_000523788.1.54423 WP_000523788.1.5451 WP_000523788.1.54629 WP_000523788.1.54752 WP_000523788.1.54818 WP_000523788.1.54821 WP_000523788.1.55451 WP_000523788.1.55655 WP_000523788.1.55753 WP_000523788.1.564 WP_000523788.1.56404 WP_000523788.1.56602 WP_000523788.1.56930 WP_000523788.1.57174 WP_000523788.1.57262 WP_000523788.1.57407 WP_000523788.1.57557 WP_000523788.1.57586 WP_000523788.1.57900 WP_000523788.1.58075 WP_000523788.1.58119 WP_000523788.1.58254 WP_000523788.1.59040 WP_000523788.1.59057 WP_000523788.1.59460 WP_000523788.1.5977 WP_000523788.1.5999 WP_000523788.1.60093 WP_000523788.1.60593 WP_000523788.1.60702 WP_000523788.1.61267 WP_000523788.1.61458 WP_000523788.1.61676 WP_000523788.1.61844 WP_000523788.1.62057 WP_000523788.1.62267 WP_000523788.1.62362 WP_000523788.1.62758 WP_000523788.1.6321 WP_000523788.1.63363 WP_000523788.1.63367 WP_000523788.1.63482 WP_000523788.1.6360 WP_000523788.1.63764 WP_000523788.1.63980 WP_000523788.1.64182 WP_000523788.1.64206 WP_000523788.1.64297 WP_000523788.1.64459 WP_000523788.1.64468 WP_000523788.1.64713 WP_000523788.1.64967 WP_000523788.1.65195 WP_000523788.1.65297 WP_000523788.1.65323 WP_000523788.1.65427 WP_000523788.1.6564 WP_000523788.1.65668 WP_000523788.1.66063 WP_000523788.1.66242 WP_000523788.1.67162 WP_000523788.1.67318 WP_000523788.1.67444 WP_000523788.1.67759 WP_000523788.1.67859 WP_000523788.1.68290 WP_000523788.1.6840 WP_000523788.1.68443 WP_000523788.1.68587 WP_000523788.1.68732 WP_000523788.1.68788 WP_000523788.1.69023 WP_000523788.1.69034 WP_000523788.1.69077 WP_000523788.1.69132 WP_000523788.1.69163 WP_000523788.1.6986 WP_000523788.1.70219 WP_000523788.1.70276 WP_000523788.1.70286 WP_000523788.1.70391 WP_000523788.1.70397 WP_000523788.1.70932 WP_000523788.1.71044 WP_000523788.1.71554 WP_000523788.1.71606 WP_000523788.1.7191 WP_000523788.1.7234 WP_000523788.1.72381 WP_000523788.1.72464 WP_000523788.1.72821 WP_000523788.1.73082 WP_000523788.1.73137 WP_000523788.1.73417 WP_000523788.1.73449 WP_000523788.1.73585 WP_000523788.1.73637 WP_000523788.1.73692 WP_000523788.1.73696 WP_000523788.1.73856 WP_000523788.1.74188 WP_000523788.1.74717 WP_000523788.1.74933 WP_000523788.1.74951 WP_000523788.1.75020 WP_000523788.1.75077 WP_000523788.1.75293 WP_000523788.1.7586 WP_000523788.1.75882 WP_000523788.1.76034 WP_000523788.1.7620 WP_000523788.1.76408 WP_000523788.1.76610 WP_000523788.1.76906 WP_000523788.1.76996 WP_000523788.1.77005 WP_000523788.1.77757 WP_000523788.1.77945 WP_000523788.1.78006 WP_000523788.1.78251 WP_000523788.1.78292 WP_000523788.1.78432 WP_000523788.1.78464 WP_000523788.1.7882 WP_000523788.1.79474 WP_000523788.1.79724 WP_000523788.1.80180 WP_000523788.1.80460 WP_000523788.1.80706 WP_000523788.1.81080 WP_000523788.1.81115 WP_000523788.1.81303 WP_000523788.1.81506 WP_000523788.1.82198 WP_000523788.1.82293 WP_000523788.1.82501 WP_000523788.1.82730 WP_000523788.1.83071 WP_000523788.1.83198 WP_000523788.1.8340 WP_000523788.1.83465 WP_000523788.1.8362 WP_000523788.1.84119 WP_000523788.1.84227 WP_000523788.1.84273 WP_000523788.1.84343 WP_000523788.1.85179 WP_000523788.1.852 WP_000523788.1.85914 WP_000523788.1.85966 WP_000523788.1.8625 WP_000523788.1.86651 WP_000523788.1.87307 WP_000523788.1.87395 WP_000523788.1.87807 WP_000523788.1.87880 WP_000523788.1.87882 WP_000523788.1.88071 WP_000523788.1.88296 WP_000523788.1.88344 WP_000523788.1.887 WP_000523788.1.89132 WP_000523788.1.89248 WP_000523788.1.89336 WP_000523788.1.89477 WP_000523788.1.89574 WP_000523788.1.89608 WP_000523788.1.90019 WP_000523788.1.90068 WP_000523788.1.90074 WP_000523788.1.90214 WP_000523788.1.90411 WP_000523788.1.90664 WP_000523788.1.91002 WP_000523788.1.91223 WP_000523788.1.91285 WP_000523788.1.9136 WP_000523788.1.91673 WP_000523788.1.92184 WP_000523788.1.92219 WP_000523788.1.92320 WP_000523788.1.92547 WP_000523788.1.92590 WP_000523788.1.92647 WP_000523788.1.9295 WP_000523788.1.93080 WP_000523788.1.93303 WP_000523788.1.93537 WP_000523788.1.93793 WP_000523788.1.93825 WP_000523788.1.93881 WP_000523788.1.94346 WP_000523788.1.94532 WP_000523788.1.94803 WP_000523788.1.94973 WP_000523788.1.95950 WP_000523788.1.96087 WP_000523788.1.96406 WP_000523788.1.96868 WP_000523788.1.96943 WP_000523788.1.9711 WP_000523788.1.9741 WP_000523788.1.97836 WP_000523788.1.97850 WP_000523788.1.98063 WP_000523788.1.98185 WP_000523788.1.9822 WP_000523788.1.98370 WP_000523788.1.98773 WP_000523788.1.98979 WP_000523788.1.99019 WP_000523788.1.99056 WP_000523788.1.99241 WP_000523788.1.99286 WP_000523788.1.99447 gi|512539037|ref|YP_008084541.1| gi|76788588|ref|YP_329547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]