SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512539545|ref|YP_008085049.1| from Streptococcus agalactiae 09mas018883

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512539545|ref|YP_008085049.1|
Domain Number 1 Region: 148-262
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.46e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 9-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000038
Family Glutathione S-transferase (GST), N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|512539545|ref|YP_008085049.1|
Sequence length 284
Comment Glutathione S-transferase domain protein [Streptococcus agalactiae 09mas018883]
Sequence
MTTFTAKFIDQEWEVPVESGRYHMIVGEFCPYAQRPQIARQLLGLDKHISISFVDDVPSD
IGLIFSQPEQVTGAKSLRDIYHLTDPTYKGPYTIPILIDKTDNRIVCKESADMLRLFTTD
FSDLHQEDAPVLFSQETASLIDNDIKDINNNFQSLMYKLAFLDKQADYDTYSKEFFTFLD
QKEHLLGQRPFLLGDNLSEVDIHFFTPLVRWDIAGRDLLLLNQKALEDYPNIFSWAKTLY
NDFNLKTLTNPQSIKNNYYLGKFGRAVRHHTIVPTGPNMVKWEK
Download sequence
Identical sequences A0A0H1WJH3 Q8E4L0
WP_000206683.1.10029 WP_000206683.1.101296 WP_000206683.1.101830 WP_000206683.1.101853 WP_000206683.1.101864 WP_000206683.1.102056 WP_000206683.1.10723 WP_000206683.1.11465 WP_000206683.1.1163 WP_000206683.1.12102 WP_000206683.1.1251 WP_000206683.1.12619 WP_000206683.1.14275 WP_000206683.1.14563 WP_000206683.1.14738 WP_000206683.1.16134 WP_000206683.1.16165 WP_000206683.1.16342 WP_000206683.1.16595 WP_000206683.1.17056 WP_000206683.1.17339 WP_000206683.1.17489 WP_000206683.1.1775 WP_000206683.1.18933 WP_000206683.1.21722 WP_000206683.1.23384 WP_000206683.1.24475 WP_000206683.1.25647 WP_000206683.1.25781 WP_000206683.1.26046 WP_000206683.1.2651 WP_000206683.1.27583 WP_000206683.1.27958 WP_000206683.1.28021 WP_000206683.1.29352 WP_000206683.1.29719 WP_000206683.1.30252 WP_000206683.1.3074 WP_000206683.1.3112 WP_000206683.1.32520 WP_000206683.1.32818 WP_000206683.1.34227 WP_000206683.1.34276 WP_000206683.1.34896 WP_000206683.1.35428 WP_000206683.1.36977 WP_000206683.1.37018 WP_000206683.1.37098 WP_000206683.1.38578 WP_000206683.1.3880 WP_000206683.1.38842 WP_000206683.1.40015 WP_000206683.1.43138 WP_000206683.1.44371 WP_000206683.1.44712 WP_000206683.1.46116 WP_000206683.1.48052 WP_000206683.1.48557 WP_000206683.1.50552 WP_000206683.1.50776 WP_000206683.1.50874 WP_000206683.1.51102 WP_000206683.1.52273 WP_000206683.1.52634 WP_000206683.1.52826 WP_000206683.1.54416 WP_000206683.1.54423 WP_000206683.1.54487 WP_000206683.1.54896 WP_000206683.1.55753 WP_000206683.1.57174 WP_000206683.1.57336 WP_000206683.1.57557 WP_000206683.1.57586 WP_000206683.1.58075 WP_000206683.1.58988 WP_000206683.1.60593 WP_000206683.1.61267 WP_000206683.1.61458 WP_000206683.1.61676 WP_000206683.1.6321 WP_000206683.1.63363 WP_000206683.1.63482 WP_000206683.1.63508 WP_000206683.1.6360 WP_000206683.1.63980 WP_000206683.1.64297 WP_000206683.1.64459 WP_000206683.1.64468 WP_000206683.1.64713 WP_000206683.1.65036 WP_000206683.1.65297 WP_000206683.1.67162 WP_000206683.1.67318 WP_000206683.1.67444 WP_000206683.1.67476 WP_000206683.1.68290 WP_000206683.1.6840 WP_000206683.1.68587 WP_000206683.1.68641 WP_000206683.1.68732 WP_000206683.1.69077 WP_000206683.1.70219 WP_000206683.1.70286 WP_000206683.1.70879 WP_000206683.1.70897 WP_000206683.1.71044 WP_000206683.1.7191 WP_000206683.1.7234 WP_000206683.1.73137 WP_000206683.1.73417 WP_000206683.1.73637 WP_000206683.1.73696 WP_000206683.1.74188 WP_000206683.1.74951 WP_000206683.1.75077 WP_000206683.1.75293 WP_000206683.1.76408 WP_000206683.1.76906 WP_000206683.1.76996 WP_000206683.1.77005 WP_000206683.1.78251 WP_000206683.1.78432 WP_000206683.1.78464 WP_000206683.1.79724 WP_000206683.1.80706 WP_000206683.1.81303 WP_000206683.1.82501 WP_000206683.1.82730 WP_000206683.1.84119 WP_000206683.1.84343 WP_000206683.1.84909 WP_000206683.1.85914 WP_000206683.1.87395 WP_000206683.1.87412 WP_000206683.1.87697 WP_000206683.1.87807 WP_000206683.1.87880 WP_000206683.1.88071 WP_000206683.1.88248 WP_000206683.1.88296 WP_000206683.1.88344 WP_000206683.1.89477 WP_000206683.1.89574 WP_000206683.1.89608 WP_000206683.1.90214 WP_000206683.1.90411 WP_000206683.1.90664 WP_000206683.1.91285 WP_000206683.1.91673 WP_000206683.1.92320 WP_000206683.1.92647 WP_000206683.1.92762 WP_000206683.1.93303 WP_000206683.1.93537 WP_000206683.1.94803 WP_000206683.1.96087 WP_000206683.1.96868 WP_000206683.1.96943 WP_000206683.1.98063 WP_000206683.1.9822 WP_000206683.1.99056 WP_000206683.1.99286 211110.gbs1391 gi|512539545|ref|YP_008085049.1| gi|25011433|ref|NP_735828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]