SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383761601|ref|YP_005440583.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383761601|ref|YP_005440583.1|
Domain Number 1 Region: 918-1086,1118-1234
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.16e-53
Family Complement components 0.0016
Further Details:      
 
Domain Number 2 Region: 1336-1432
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.0000000000000183
Family Alpha-macroglobulin receptor domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383761601|ref|YP_005440583.1|
Sequence length 1449
Comment hypothetical protein CLDAP_06460 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MYIIGQFEHLTPGSTTSFLVYVRDDNLSDSVTAADRPVTVSLEEPNQGEIQLFSGQTDKN
GAVRVEFKTPELAASGYRRLLVHADAPSGPRFFAQDVYIGRTYNVLISTDRPVYQPGQMI
HLRTLALDALDLRAAAGETMTITLADPQGNKLMRRDLPTSQYGVASLDFPLDTQAPSGHY
TLTAEIGPNQASRTVEVKPYRLPRFQIAFRPDRSFYLPGEIATGVIEARYFFGKPVTGGK
VTVRGVMTDVAEETVFELAGETDAEGVFRYEAPVPEFLVGQFGNRSAQIDLTIEVVDTAN
HLEAIDENMIVAEQPLLIDAVPESGVLKPGLENRIYLDVTTPDGAPAQAALQIALPSLSV
TTTATTDLYGLAVITVTPPSGRHLPIEIEAIDGEGRTVVQRLLLGSDTQVGSAVLMRPER
SEYKVGETANIDIFVNGNATTVYLDVIKGRQTFAMVALPVVNGAARAAIPIDGSLLGTLE
LSAYVIDSKGELVRDHRLLLVNPAPAEVTVTPDADVYRPGDIAMLDIQVQREGTAMPGVI
GLAIVDESVFFVQEQDPGFARTYFLLNRELQEPRYQIKDFVELPDDADSPYDDSFESPRY
IAQARDRALAGLFAQELAARQAAQPKESVTAPSLPTSIAMSWGNRLYLLAPLVGLALYDG
RRKRRHLLIALTLFALAAFFWSACAAPAAQAPAASAPAIAETAATPRPEAPRLRQFFPET
LYWLPELQTDAQGRARVEIPIADSITTWRVSVLASDAAGNLGSAQARLRVYQEFFVEPDL
PRFLTVGDEIEAPVSVYNYLDEPQWIEFELTPGDWYELTGEPPHKIAVNANEVTVVYVPM
RVLRHGVHNFQITAIGTSLSDAVVRQVEVLPDGQQVANSFGGRLEKSQRFPVLRPAAAIP
ETDRLIVRIYPGLISQALSGLEGLLQIPHGCFEQTSSITFPNVLVLDFLKASGQASPALQ
MQAEHLIHLGYQRLLSFEVDETPGGFSLFGEPPAQVMLTAFGLMEFTAMSRVAYVDPALI
ERIAAFLADHQNQDGSWNPEDTIVLTGMDKNQSRLNATAYIVWALADADAEPIAVRRGVR
YLQDALKRSLAAGLPQPQSAIGAAALAAAGQRGSAAGEEATLSDYTLALIANALIAADAD
PTRALEALASRAKRMGNTAHWGGDGVTFLGSYGPVEQIETTAVAAQALLRSGYAPALAIQ
ALDYLIQHRDAYGSFYTTQATVQALRALALAARLEGEGDTATVTITLTSTDGKAQSRTLI
VDANNADLVHQVVFEGGKSETAELEITVRGDRALFYQVVTSFYVPWDLVSEPSAAGQPMR
VSVVYDRAELAVNETVQATATVELLRAGRAGTVLVDLGIPPGFEPLTEDLDALVKEGKID
RYELTGRQIILYLTDVASGRPLEFSYRLRALYPVRAQTTASRVFDYYTPDQGNVEPPQRI
IVELGTPKR
Download sequence
Identical sequences I0I098
gi|383761601|ref|YP_005440583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]