SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383762506|ref|YP_005441488.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383762506|ref|YP_005441488.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 6.02e-32
Family Thiamin pyrophosphokinase, catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000432
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383762506|ref|YP_005441488.1|
Sequence length 223
Comment thiamine pyrophosphokinase [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MRAIVAVNGLIQDYALLQPLLHSDAYRVAADGGAMHWLALGHAPHVVVGDLDSLPAELVE
RLAAQGVRIERHPREKDQTDIELAIERAIEDGADEVLLIGALGGRLDQTLANVLLLAQRS
WPVPIRLIEGGQIAEVLRGPGTIEFTGTPGDVVSLLPLSPTVQGVTYRGLRYPLENAELS
FGTTRAISNEMLEPNASIFIQQGIALVVRTLNYLSDEEPGDEP
Download sequence
Identical sequences I0I2V3
WP_014432829.1.81527 gi|383762506|ref|YP_005441488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]