SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383762635|ref|YP_005441617.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383762635|ref|YP_005441617.1|
Domain Number 1 Region: 37-211
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.8e-34
Family HD domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383762635|ref|YP_005441617.1|
Sequence length 213
Comment hypothetical protein CLDAP_16800 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MNEKEPAWRAQCRTLAQERAEKEVRATLNLRPEEPIPFNYRWEHVQRVVQVALWLAERTD
ADREVVEAAAWLHDIRKGEPNHGTIGAVEAGMFLQQSDFPSEKIARVVDAIERHAGLTRP
PGAPPLEPLETAVLWDADKLTKLGVSMIAQQLSTRQFDGMSLAERRQEMQKFLRTVLSKT
VESMNTAPARHLAQVRYRAMASFLNEWESEEKL
Download sequence
Identical sequences I0I382
WP_014432957.1.81527 gi|383762635|ref|YP_005441617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]