SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383763451|ref|YP_005442433.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383763451|ref|YP_005442433.1|
Domain Number 1 Region: 32-154
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.49e-21
Family Cytochrome c3-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383763451|ref|YP_005442433.1|
Sequence length 161
Comment cytochrome c-type protein NrfH [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MTDERSSAQSARYWLAGLALMFGVLVGLSAFTFVYAEGFSYFSDDPNACVNCHIMREQFD
GWNHSTHKAVATCNDCHTPHAFPDKWIVKGINGFNHSLAFTLGTYPEHLHIRDFNARIAE
QNCRDCHTTVVSAIEHFVSEEPLQCVRCHGNVGHGNVAHGP
Download sequence
Identical sequences I0I5J8
WP_014433768.1.81527 gi|383763451|ref|YP_005442433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]