SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383763589|ref|YP_005442571.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383763589|ref|YP_005442571.1|
Domain Number 1 Region: 743-837
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000307
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 630-743
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000288
Family Collagen-binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|383763589|ref|YP_005442571.1|
Domain Number - Region: 950-1006
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0173
Family Integrin alpha N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383763589|ref|YP_005442571.1|
Sequence length 1311
Comment hypothetical protein CLDAP_26340 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MACALFVYERVSVARSAPTLTAADVLGAVRVRDVDAGAPSLRSDRLVFNLTGVQSPPSGF
TLQAYLAANENGFFCGELQVSGGAVNTVLDYPGVNLIGKYDSLRMMWEQEIFAATLPTAA
LALIREVVARADDTPGNVGYGVGLVQEARMLLTHANLARSSAAAGSLAGARVHTEHVLNI
LYGKDDPRYGDYDGNGVAENPGDGFGLLRYAANVDLNMLTAAESAGVTDHIFNQAVAASA
VIGNFAPADGGNTWSDQIVTQAAQVLASASAATALTPSTAARDLAMRIVDGIDANSNGVV
EEIAGEGGAVTAFTAVQRAADYFPPGPITGLVEHGASTNNPTSDRIQIALDNVPAPPGGF
TLWGYLVAPNGERLLLGELPWSSGKVEATFSYPGRNLIAEFGAFRLVRGAIYAEDKLPVA
PLTALRKVLATADDTPNRVGYGVGLMQQAQLLRDLAAQSSAAAQADNLALAKQRAGEALN
VLVGPSDPRFNAAFANPGDGFGLLRHAAGSDLALSQVAGDAAATVNMATQAAAARVALAN
VAPAAGQGTWSDQLITQIQQVLAASTAAAAAPAAGQAALLADRILNGAGSDGGTRAAYQS
SQAVSDYFPTEAGASQPTQPPVPGVNPDAFENDDVCSRAVNISTEGAPQRRTFHYEGDQD
WVRFTAQANKSYVIDVTGVGALADPVVFLYDACDAAPGSFENNAFGNSVRLIWNATRNGT
YYIQLRQFDPAVFGENTEYDLRVTLDTTPPSPPTNLRCLAIDQNTLAIQWRRSPEFDVAG
YQVTYGNQAATDTGIRDVAGADVTFIELGGLTPNELYFLTVTALDFSRNVSAPSGELQCR
PVQPADATRPTITALQPTAAAVFTTTAPSLTFSGAVQDAGGNLSRVRVRNASINQERTDF
TLAGAAAAFRVQDVPLRVGVNDVRVTVFDEANNSIEQRIEVRRLADSAGAVIIVAGHNET
FGLQTNIYNATNRAYRIFLSAGFAADDIYYLAPVAQDADGDGTPDTRTVTFGPAAVEQAI
KQFAAGRVGPGKPLYLYLMDHGFADRYCVTGCTPGNIIAPKALNEWLRIVEDQTGLNEVN
IFIEACQSGSFLDNLEGEATNPLNSLARQGRVVVTSTGRVNNAYASADGAFFSDAFFSCL
ADSGSMKACFDEATTAVALTGVDQTPWLDDNADGVPNSGDGATASQRTLTRFFSSVRPRI
LSTQVTRSGQSALLTAEVEAGAETLRLVWAAVYPPSFQEPSGVTLNLNVPIVRLEPDPTT
PGRFAFNYVDGFTEEGDYRIVFYAQDRLGISAPPRRHGATNEQLYLPVIAR
Download sequence
Identical sequences I0I5Y6
gi|383763589|ref|YP_005442571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]