SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383764620|ref|YP_005443602.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383764620|ref|YP_005443602.1|
Domain Number 1 Region: 53-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.76e-29
Family Matrix metalloproteases, catalytic domain 0.044
Further Details:      
 
Domain Number 2 Region: 263-358
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000144
Family Collagen-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383764620|ref|YP_005443602.1|
Sequence length 362
Comment hypothetical protein CLDAP_36650 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MYLKDIRACVDRVLTGPRRQRAIRRSIELNPANAMMVEAPPTIAGIELPMSLALVTSKLW
KPGMTLRVRFLDGDPVVQQRLQPFAHVWSQYANLKFAFVDDPDAEIRISFKNRGSWSYIG
TDALGIPKNQPTMNFGWLTRDTDDREYSRVVTHEFGHAIACIHEHQNPASSIPWNKPVVY
RYYAGPPNYWTKEQTDVNLFQTYARDQTQFSEFDPKSIMLYPIPKEFTIGGFEVGWNTEL
SETDKQFVATVYPFEEKREKELMIDGEPLSESIGKPGELDRFKFVVRERGRYRVETLGRL
DLVMGLYGPDNEEKLLHSDDDSGVGLNPRIVRTLEPGVYHVQVRHFSSRKTGKYQIQVKR
ER
Download sequence
Identical sequences I0I8W7
gi|383764620|ref|YP_005443602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]