SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383764732|ref|YP_005443714.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383764732|ref|YP_005443714.1|
Domain Number 1 Region: 892-1094
Classification Level Classification E-value
Superfamily TPR-like 1.77e-23
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 78-225
Classification Level Classification E-value
Superfamily TPR-like 1.58e-20
Family BTAD-like 0.026
Further Details:      
 
Domain Number 3 Region: 240-478
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-19
Family Extended AAA-ATPase domain 0.033
Further Details:      
 
Domain Number 4 Region: 753-900
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000106
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Weak hits

Sequence:  gi|383764732|ref|YP_005443714.1|
Domain Number - Region: 2-44
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00349
Family PhoB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383764732|ref|YP_005443714.1|
Sequence length 1181
Comment putative serine/threonine protein kinase [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MHSGAVLRRERLAALFWPDQPQASALRNLRTALSRMRRGLGSLSHALQAESQTVTFLPPS
DVWVDALAVNALAAEVEAHTHRRLVGCPACIEKLQRLAELYQGEFLAGFTQESDLFEEWA
ATQRELYHRTAIQAFDALAGYHLLRQEWQEAQRYAQRALQFEPWREESHRHLMWALAGQN
QRSAALRQFRRCLRILEQEFNASPQPETIELYERILHQGKAIPETDRVRSSMQLTTTGAH
WLDDLPLVGRKQEIAKLLELLVSPVTRLISVVGEGGVGKTRLALRAARHTALCFPDGAFY
VRLNPEEQPEAQPLQQLEAAARVAQHIALACAIPLNEKENYKERVIAFLRKRSVLLVLDS
FEQHEEATPFLLSLLENAPACVILVTTHRPLNVRQEHVLRLEGLNLASHPDDASCNDHGS
YTEAQVATPDALALFDVLARRRGMVGVLDAMHQPAVAQICQAVGGLPLGIELAVACLPHL
DRLQAGLWSAAELAQLLERAAEPDTQLLRDLPPRHRGLRALFQTAWRLLDPACQNALAGV
AIFRSPFAVEAATTMLGLRDPDQTAHLLWKLTERSLVQPGAQGRFQLHDRIHRFATEQLA
ASPTQTALIRERYTTFFLENLAKAEQALDGEDAAAVQQRLAFEMEDLLAAWRNAVEEHRW
ELLADAASAFARFHALRGLYNEGEHLLSETVRRLRKAHFAAIAQPPGDSRPFSTDDTRKR
SGHARDLAQSEALSSALFERNSNVATTLARALARLLIAWNRLLVRLNQRETAEVVLLEAL
ELTDEPAIRTDALIELGWCLFHLGRTADAMPPLREALALADHLEDARRRAYALNGLAALS
QRRSESATAQALLEEALSLARQEGDLTMVAAILGNLSILYNELGDHARELTLVKEALAIH
RAQHNFRMEASTLYSLGIYYDVRGQYTEAQDHYHQALKLAELLDDRLTLLEIWTNIGISR
DQMGDYASALEATHHALTIEREVNNPQIRCTLFANLSLHYHHLGNQLQALAYAQKAIDLA
NAIEMPIVAAYGYDFQGHALLASGRVDEATQAYLQALHLREQKGFTILGFESRAGLARAA
LARGDRKSAAAWVEPIAEHILNATLEGPEEPLRVYWTVYQVMRTVNDPRQSFILQSAVTL
IHARAERISDANSRRLYLNQVEAHRELLQASTDMNRRKKEE
Download sequence
Identical sequences I0I979
gi|383764732|ref|YP_005443714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]