SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL003C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL003C
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily Histone-fold 3.14e-46
Family Nucleosome core histones 0.00000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL003C   Protein: S000000099
Sequence length 132
Comment HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p"
Sequence
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKTAKASQEL
Download sequence
Identical sequences A0A0L8VV98 A0A250WFE6 A6ZKU5 B3LNE2 C7GM51 C8Z3Z5 E7Q0U1 E7QBB8 G2W906 N1P913 P04912
YBL003C YBL003C NP_009552.1.97178 YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C YBL003C 4932.YBL003C SCRT_02966 tr|A6ZKU5|A6ZKU5_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]