SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL084C
Domain Number 1 Region: 537-743
Classification Level Classification E-value
Superfamily TPR-like 3.29e-44
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 2 Region: 432-585
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000417
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 
Weak hits

Sequence:  YBL084C
Domain Number - Region: 66-200
Classification Level Classification E-value
Superfamily TPR-like 0.000976
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL084C   Protein: S000000180
Sequence length 758
Comment CDC27 SGDID:S000000180, Chr II from 69442-67166, reverse complement, Verified ORF, "Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition"
Sequence
MAVNPELAPFTLSRGIPSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSIL
DKSSVYWSDAVYLYALSLFLNKSYHTAFQISKEFKEYHLGIAYIFGRCALQLSQGVNEAI
LTLLSIINVFSSNSSNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEA
LAINPYLWESYEAICKMRATVDLKRVFFDIAGKKSNSHNNNAASSFPSTSLSHFEPRSQP
SLYSKTNKNGNNNINNNVNTLFQSSNSPPSTSASSFSSIQHFSRSQQQQANTSIRTCQNK
NTQTPKNPAINSKTSSALPNNISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNND
RNHQNNNNNNNNNNNNNNNNNNNNNNNNIINKTTFKTPRNLYSSTGRLTTSKKNPRSLII
SNSILTSDYQITLPEIMYNFALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGK
LHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKP
ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA
LACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEK
ALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTY
RIVGRKKDAIKELTVAMNLDPKGNQVIIDELQKCHMQE
Download sequence
Identical sequences YBL084C 4932.YBL084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]