SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR055C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR055C
Domain Number 1 Region: 299-771
Classification Level Classification E-value
Superfamily TPR-like 8.21e-28
Family HAT/Suf repeat 0.059
Further Details:      
 
Domain Number 2 Region: 732-870
Classification Level Classification E-value
Superfamily TPR-like 0.000000000224
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 
Domain Number 3 Region: 219-286
Classification Level Classification E-value
Superfamily TPR-like 0.0000224
Family HAT/Suf repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR055C   Protein: S000000259
Sequence length 899
Comment PRP6 SGDID:S000000259, Chr II from 347299-344600, reverse complement, Verified ORF, "Splicing factor, component of the U4/U6-U5 snRNP complex"
Sequence
MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPK
DDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWM
DIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQ
LTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTN
PQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAI
NFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEK
ATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDK
LVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYES
ELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELL
FQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFK
IKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERC
LKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPV
RARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKL
FKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGD
TWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK
Download sequence
Identical sequences N1P9D6 P19735
YBR055c___KOG0495 4932.YBR055C NP_009611.1.97178 YBR055C YBR055C 3jcm_G 5gan_J 5gap_J 5nrl_J 5zwm_N 5zwo_N YBR055C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]