SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR155W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR155W
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily TPR-like 2.02e-25
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR155W   Protein: S000000359
Sequence length 385
Comment CNS1 SGDID:S000000359, Chr II from 549765-550922, Verified ORF, "TPR-containing co-chaperone; binds both Hsp82p (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase activity of SSA1, ts mutants reduce Hsp82p function while over expression suppresses the phenotypes of an HSP82 ts allele and a cpr7 deletion"
Sequence
MSSVNANGGYTKPQKYVPGPGDPELPPQLSEFKDKTSDEILKEMNRMPFFMTKLDETDGA
GGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSIN
ESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATF
ANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENKKIMLESAMTLRNITNIK
THSPVELLNEGKIRLEDPMDFESQLIYPALIMYPTQDEFDFVGEVSELTTVQELVDLVLE
GPQERFKKEGKENFTPKKVLVFMETKAGGLIKAGKKLTFHDILKKESPDVPLFDNALKIY
IVPKVESEGWISKWDKQKALERRSV
Download sequence
Identical sequences A0A250WFS9 A6ZL97 N1P9I2 P33313
YBR155W YBR155W YBR155W 4932.YBR155W YBR155W tr|A6ZL97|A6ZL97_YEAS7 YBR155W YBR155W YBR155W NP_009713.1.97178 YBR155W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]