SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR060W
Domain Number 1 Region: 10-66
Classification Level Classification E-value
Superfamily TPR-like 8.21e-17
Family SCOPe 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YCR060W   Protein: S000000656
Sequence length 111
Comment TAH1 SGDID:S000000656, Chr III from 224395-224730, Verified ORF, "HSP90 cofactor; interacts with Hsp82p, Pih1p, Rvb1 and Rvb2, contains a single TPR domain with at least two TPR motifs"
Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM
CQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Download sequence
Identical sequences A0A0L8VUI0 A6ZTN6 B3LUC0 C8Z4E9 E7KA60 E7Q1G2 P25638
NP_009986.1.97178 YCR060W YCR060W 000145937|e2l6jA1|109.4.1.114|A:1-111 YCR060W YCR060W 4932.YCR060W tr|A6ZTN6|A6ZTN6_YEAS7 2l6j_A 4cgq_A YCR060W APC7675 YCR060W YCR060W YCR060W YCR060W YCR060W SCRT_05453 YCR060W YCR060W YCR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]