SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL160C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDL160C-A
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily Histone-fold 0.0321
Family TBP-associated factors, TAFs 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL160C-A   Protein: S000028520
Sequence length 80
Comment YDL160C-A SGDID:S000028520, Chr IV from 169609-169367, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS
PLELSHQDLERIVGLLLMDM
Download sequence
Identical sequences A0A0L8VSC5 A6ZXG8 B3LH48 C7GL10 C8Z6E2 N1PAM3 Q3E829
YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A SCRT_00655 4932.YDL160C-A tr|A6ZXG8|A6ZXG8_YEAS7 YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A NP_878060.1.97178 YDL160C-A YDL160C-A 001177744|e3v9rD2|148.1.1.6|D:1-80 YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A YDL160C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]