SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR121W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR121W
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily Histone-fold 6.62e-24
Family TBP-associated factors, TAFs 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR121W   Protein: S000002528
Sequence length 196
Comment DPB4 SGDID:S000002528, Chr IV from 693583-694173, Verified ORF, "Shared subunit of DNA polymerase (II) epsilon and of ISW2/yCHRAC chromatin accessibility complex; involved in both chromosomal DNA replication and in inheritance of telomeric silencing"
Sequence
MPPKGWRKDAQGNYPTTSYIKEQENITIQDLLFPKSTIVNLAREVPQQSGKKLLINKDAS
LALQRGATVFVNHLLLFAREIAKSQDKKSCSVDDVLSALDHIGHSALKGPVRDKLDEYQA
AVEQRKKEKLDSGEVDADGDIDMGEDKENVPVEKVKEHDEIEEQGDALQDVEESSEKKQK
TESQDVETRVQNLEQT
Download sequence
Identical sequences Q04603
YDR121W 4932.YDR121W YDR121W YDR121W YDR121W NP_010406.3.97178 YDR121W YDR121W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]