SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR139C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR139C
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.73e-24
Family Ubiquitin-related 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR139C   Protein: S000002546
Sequence length 77
Comment RUB1 SGDID:S000002546, Chr IV from 733922-733774,733700-733616, reverse complement, Verified ORF, "Ubiquitin-like protein with similarity to mammalian NEDD8; conjugation (neddylation) substrates include the cullins Cdc53p, Rtt101p, and Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair); conjugation mediated by Ubc12p (E2 enzyme)"
Sequence
MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH
LVEGMQLHLVLTLRGGN
Download sequence
Identical sequences A6ZY99 B3LGE0 C7GIP4 C8Z555 G2WAN9 N1P4T1 Q03919
NP_010423.4.97178 YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C SCRT_00381 YDR139C YDR139C tr|A6ZY99|A6ZY99_YEAS7 YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C YDR139C 4932.YDR139C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]