SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR161W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR161W
Domain Number 1 Region: 16-75,163-199,240-274
Classification Level Classification E-value
Superfamily TPR-like 0.00000000911
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR161W   Protein: S000002568
Sequence length 387
Comment YDR161W SGDID:S000002568, Chr IV from 779041-780204, Uncharacterized ORF, "Putative protein of unknown function; non-essential gene; proposed function in rRNA and ribosome biosynthesis based on transcriptional co-regulation"
Sequence
MSELEATIRQAKEALAENNAKKALKILKPFKSSLKKENANNVILNEVFADAYLDNGQVEK
AYPILARACELDPEGQVGGPDKFFTMGQIMGGQDGVSIITRGIMNISNTGGEMLTNVQVE
KIVGGLLSVIEIWMTDLCMEPNAEEQCEELIQKAMELTEGKSPETWSTLGSIKISQQKFG
EAYEAFSQAWNFFELKKQEIGSGINENGDTTQKAGLQSEYVDLLQPLLSLTKMCLEVGAY
EVALKVIAAVRDIDEDNIEGYYLEGFTYYLMSKLEIFKLNNPEVSLRPENIYEFNQLIQE
VPLDLSHEPISQLIYDSRLALSFALQAGVNADSKDEIVQELLGGANALLQEIGGPLDPSE
LTQIKKGDLVNENEDLEELDIEEEYSD
Download sequence
Identical sequences A0A0L8VT46 B3LGC3 C7GQF8 E7KAX0 E7LSQ9 H0GDI2 Q03771
YDR161W YDR161W YDR161W SCRT_00362 YDR161W YDR161W YDR161W YDR161W YDR161W 4932.YDR161W YDR161W YDR161W 354906 NP_010445.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]